Structure of PDB 5k2m Chain G

Receptor sequence

>5k2mG (length=273) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]

MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRN
VSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWK
AALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKW
MKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGG
KAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKN
AARVTGADMAGKLVEYAVEVAKT

3D structure

PDB

5k2m Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.

Chain

Resolution

2.18 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	G	V51 S52 H53 F54 F125 S127 W128 R130 Y156 R173 R187 T196 A197 N243 P244 N245 E247 F248 N250 A251	V51 S52 H53 F54 F125 S127 W128 R130 Y156 R173 R187 T196 A197 N243 P244 N245 E247 F248 N250 A251
BS02	ADP	G	K83 V120 K122 S127 G129 Q162 V165 K167 D171 W192 T194 N195 F231 N240 E241	K83 V120 K122 S127 G129 Q162 V165 K167 D171 W192 T194 N195 F231 N240 E241
BS03	MG	G	D229 E241	D229 E241

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0005524	ATP binding
GO:0043774	coenzyme F420-2 alpha-glutamyl ligase activity
GO:0046872	metal ion binding

	Biological Process
GO:0009085	lysine biosynthetic process
GO:0036211	protein modification process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5k2m, PDBe:5k2m, PDBj:5k2m
PDBsum	5k2m
PubMed	27566549
UniProt	Q5JFW0

[Back to BioLiP]