Structure of PDB 5j4t Chain G

Receptor sequence

>5j4tG (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence]

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

PDB

5j4t Distortion of the ligand molecule as a strategy for modulating binding affinity: Further studies involving complexes of jacalin with beta-substituted disaccharides.

Chain

Resolution

1.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	G	T10 P61 Y64 L112 L133	T10 P61 Y64 L112 L133
BS02	peptide	G	N105 P107 I108 E109 N110 L133	N105 P107 I108 E109 N110 L133
BS03	peptide	G	V79 F104 D125 Y126 F127 S128 M129 Y130 L131	V79 F104 D125 Y126 F127 S128 M129 Y130 L131
BS04	MBG	G	G1 Y78 G121 Y122 W123 D125	G1 Y78 G121 Y122 W123 D125

Gene Ontology

	Molecular Function
GO:0019862	IgA binding
GO:0030246	carbohydrate binding

	Biological Process
GO:0008150	biological_process

	Cellular Component
GO:0005575	cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5j4t, PDBe:5j4t, PDBj:5j4t
PDBsum	5j4t
PubMed	28111895
UniProt	P18670\|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]