Structure of PDB 5hz9 Chain G

Receptor sequence
>5hz9G (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]
SHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD
ILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKW
DGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
3D structure
PDB5hz9 Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
ChainG
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 5M8 G V33 F58 V35 F60 MOAD: Ki=0.093uM
BindingDB: Ki=93nM
BS02 5M8 G F28 Q32 F30 Q34 MOAD: Ki=0.093uM
BindingDB: Ki=93nM
BS03 5M8 G T54 S56 A76 T56 S58 A78 MOAD: Ki=0.093uM
BindingDB: Ki=93nM
BS04 5M8 G F58 K59 D78 F60 K61 D80 MOAD: Ki=0.093uM
BindingDB: Ki=93nM
BS05 5M8 G V33 T57 V35 T59 MOAD: Ki=0.093uM
BindingDB: Ki=93nM
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008092 cytoskeletal protein binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
GO:0070538 oleic acid binding
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0015909 long-chain fatty acid transport
GO:0032365 intracellular lipid transport
GO:0042632 cholesterol homeostasis
GO:0046320 regulation of fatty acid oxidation
GO:0050873 brown fat cell differentiation
GO:0055091 phospholipid homeostasis
GO:0071073 positive regulation of phospholipid biosynthetic process
GO:0140214 positive regulation of long-chain fatty acid import into cell
GO:2001245 regulation of phosphatidylcholine biosynthetic process
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5hz9, PDBe:5hz9, PDBj:5hz9
PDBsum5hz9
PubMed27658368
UniProtP05413|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)

[Back to BioLiP]