Structure of PDB 5gsu Chain G

Receptor sequence
>5gsuG (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEIL
ELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQA
VLLPK
3D structure
PDB5gsu Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
ChainG
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R31 R44 I45 G46 A47 K77 T78 R79 R16 R29 I30 G31 A32 K62 T63 R64
BS02 dna G K17 R19 R31 R34 R44 K2 R4 R16 R19 R29
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gsu, PDBe:5gsu, PDBj:5gsu
PDBsum5gsu
PubMed27992841
UniProtQ96QV6|H2A1A_HUMAN Histone H2A type 1-A (Gene Name=H2AC1)

[Back to BioLiP]