Structure of PDB 5eea Chain G

Receptor sequence
>5eeaG (length=63) Species: 9606 (Homo sapiens) [Search protein sequence]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAKVK
3D structure
PDB5eea Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
ChainG
Resolution2.195 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R217 K218 R220 I221 Y223 Q259 I262 N266 K270 R1 K2 R4 I5 Y7 Q43 I46 N50 K54 PDBbind-CN: Kd=41nM
BS02 dna G R220 P222 K243 R246 Q265 R268 R4 P6 K27 R30 Q49 R52 PDBbind-CN: Kd=41nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5eea, PDBe:5eea, PDBj:5eea
PDBsum5eea
PubMed29638214
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]