Structure of PDB 5dm7 Chain G

Receptor sequence

>5dm7G (length=142) Species: 1299 (Deinococcus radiodurans)

KTYIPKNDEQNWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDF
VVVINAAQVALTGKKLDDKVYTRYTGYQGGLKTETAREALSKHPERVIEH
AVFGMLPKGRQGRAMHTRLKVYAGETHPHSAQKPQVLKTQPL

3D structure

• PDB: 5dm7 Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
• Chain: G
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K30 T31 I33 W41 G48 P50 L51 G52 R53 T56 K65 P72 N73 T91 K93 K94 T101 R102 Y103 T104 Y106 Q107 L110 H122 R125 E128 A130 G133 M134 K137 R139 Q140 R142 K149 P157 H158 A160 Q161 P170	K1 T2 I4 W12 G19 P21 L22 G23 R24 T27 K36 P43 N44 T62 K64 K65 T72 R73 Y74 T75 Y77 Q78 L81 H93 R96 E99 A101 G104 M105 K108 R110 Q111 R113 K120 P128 H129 A131 Q132 P141

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5dm7, PDBe:5dm7, PDBj:5dm7
• PDBsum: 5dm7
• PubMed: 26464437
• UniProt: Q9RXY1|RL13_DEIRA Large ribosomal subunit protein uL13 (Gene Name=rplM)