Structure of PDB 5cx7 Chain G |
>5cx7G (length=138) Species: 260680 (Salmonella enterica subsp. enterica serovar Livingstone) [Search protein sequence] |
VALSFHDLHQLTRAAVERAQQLQVPVVVSIVDAHGTETVTWRMPDALLVS SELAPKKAWTAVAMKTATHELSDVVQPGAALYGLESHLQGKVVTFGGGYA LWRDGILIGGLGISGGSVEQDMDIAQTAIAAINVGTHQ |
|
PDB | 5cx7 The Crystal Structure of the C-Terminal Domain of the Salmonella enterica PduO Protein: An Old Fold with a New Heme-Binding Mode. |
Chain | G |
Resolution | 1.97 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEM |
G |
F14 H18 R22 W50 |
F5 H9 R13 W41 |
|
|
|