Structure of PDB 5c8e Chain G

Receptor sequence

>5c8eG (length=280) Species: 262724 (Thermus thermophilus HB27)

HMTSSGVYTIAEVEAMTGLSAEVLRQWERRYGFPKPRRTPGGHRLYSAED
VEALKTIKRWLEEGATPKAAIRRYLAQEVRPEDLGTGLLEALLRGDLAGA
EALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLR
ARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLG
PDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQ
GAGPEEARRLGAEYMEDLKGLAEALWLPRG

3D structure

• PDB: 5c8e Structural basis for gene regulation by a B12-dependent photoreceptor.
• Chain: G
• Resolution: 3.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	Q25 W26 R29 Y30 G40 H42 P66 K67	Q26 W27 R30 Y31 G41 H43 P67 K68
BS02	dna	G	I9 R24 H42 R43	I10 R25 H43 R44
BS03	B12	G	L121 L124 G128 E141 G174 R176 H177 E178 G180 S222 L225 G247 G248 Q249 M264 L267	L122 L125 G129 E142 G175 R177 H178 E179 G181 S223 L226 G248 G249 Q250 M265 L268

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0031419 cobalamin binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:5c8e, PDBe:5c8e, PDBj:5c8e
• PDBsum: 5c8e
• PubMed: 26416754
• UniProt: Q746J7