Structure of PDB 5b33 Chain G

Receptor sequence
>5b33G (length=104) Species: 9606 (Homo sapiens) [Search protein sequence]
VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVL
ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKS
LIGK
3D structure
PDB5b33 Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
ChainG
Resolution2.925 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R31 K37 R45 A48 V78 K79 R80 R15 K21 R29 A32 V62 K63 R64
BS02 dna G V17 S18 R19 R31 R34 R45 V1 S2 R3 R15 R18 R29
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b33, PDBe:5b33, PDBj:5b33
PDBsum5b33
PubMed27358293
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1)

[Back to BioLiP]