Structure of PDB 5b1m Chain G

Receptor sequence
>5b1mG (length=104) Species: 10090 (Mus musculus) [Search protein sequence]
KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAV
LLPK
3D structure
PDB5b1m Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
ChainG
Resolution2.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R29 R42 G44 A45 T76 R77 R15 R28 G30 A31 T62 R63
BS02 dna G K15 T16 R17 R29 R32 R42 K1 T2 R3 R15 R18 R28
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b1m, PDBe:5b1m, PDBj:5b1m
PDBsum5b1m
PubMed28099840
UniProtC0HKE1|H2A1B_MOUSE Histone H2A type 1-B (Gene Name=H2ac4)

[Back to BioLiP]