Structure of PDB 4z9m Chain G

Receptor sequence

>4z9mG (length=313) Species: 9606 (Homo sapiens)

REQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCI
QTGVDNPKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLD
ASKITQGSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLA
GRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHN
YDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWE
FMWNERLGYILTCPSNLGTGLRAGVHRLQKRGGGVDTADISNIDRIGRSE
VELVQIVIDGVLP

3D structure

• PDB: 4z9m Crystal structure of human sarcomeric mitochondrial creatine kinase
• Chain: G
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R166 E266 R270 C317 S319 R326 R354 V359
• Catalytic site (residue number reindexed from 1): R112 E212 R216 C263 S265 R272 R281 V285
• Enzyme Commision number: 2.7.3.2: creatine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	G	R164 R166 H225 R326 V329 H330 G358	R110 R112 H171 R272 V275 H276 G284

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004111 creatine kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups

Biological Process

• GO:0006936 muscle contraction
• GO:0016310 phosphorylation
• GO:0046314 phosphocreatine biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:4z9m, PDBe:4z9m, PDBj:4z9m
• PDBsum: 4z9m
• UniProt: P17540|KCRS_HUMAN Creatine kinase S-type, mitochondrial (Gene Name=CKMT2)