Structure of PDB 4xe5 Chain G

Receptor sequence
>4xe5G (length=32) Species: 9913 (Bos taurus) [Search protein sequence]
DPFYYDYETVRNGGLIFAALAFIVGLVIILSK
3D structure
PDB4xe5 Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
ChainG
Resolution3.901 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR G V14 F21 V10 F17
Gene Ontology
Molecular Function
GO:0017080 sodium channel regulator activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0006814 sodium ion transport
GO:0043269 regulation of monoatomic ion transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xe5, PDBe:4xe5, PDBj:4xe5
PDBsum4xe5
PubMed27050261
UniProtQ04645|ATNG_BOVIN Sodium/potassium-transporting ATPase subunit gamma (Gene Name=FXYD2)

[Back to BioLiP]