Structure of PDB 4wce Chain G

Receptor sequence

>4wceG (length=145) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVD
TGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPER
LIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG

3D structure

• PDB: 4wce Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
• Chain: G
• Resolution: 3.526 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	M1 Q3 T4 W16 G27 R28 S31 R38 K40 H48 T66 G67 K69 K73 Y75 Y76 H78 S79 H81 G83 K86 R100 E103 S105 K107 G108 M109 T113 R114 L115 K121 H133 A135 Q136 G145	M1 Q3 T4 W16 G27 R28 S31 R38 K40 H48 T66 G67 K69 K73 Y75 Y76 H78 S79 H81 G83 K86 R100 E103 S105 K107 G108 M109 T113 R114 L115 K121 H133 A135 Q136 G145
BS02	MG	G	M1 R2	M1 R2
BS03	MG	G	F65 R94	F65 R94

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wce, PDBe:4wce, PDBj:4wce
• PDBsum: 4wce
• PubMed: 26464510
• UniProt: Q2FW38|RL13_STAA8 Large ribosomal subunit protein uL13 (Gene Name=rplM)