Structure of PDB 4tyd Chain G

Receptor sequence
>4tydG (length=190) Species: 11104 (Hepatitis C virus (isolate 1)) [Search protein sequence]
APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHA
VGIFRAAVCTRGVAKAVDFVPVESMETKGSVVIVGRIILS
3D structure
PDB4tyd Structure-based design of a novel series of azetidine inhibitors of the hepatitis C virus NS3/4A serine protease.
ChainG
Resolution2.84 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H57 D81 G137 S139
Enzyme Commision number 3.6.4.13: RNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN G C97 C99 C145 C97 C99 C145
BS02 3EO G H57 V78 D81 V132 L135 K136 G137 S139 F154 R155 A156 A157 H57 V78 D81 V132 L135 K136 G137 S139 F154 R155 A156 A157
BS03 3EO G P131 V132 S133 Y134 P131 V132 S133 Y134
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0019062 virion attachment to host cell
GO:0019087 transformation of host cell by virus
GO:0046718 symbiont entry into host cell
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tyd, PDBe:4tyd, PDBj:4tyd
PDBsum4tyd
PubMed25155387
UniProtQ0ZNA6

[Back to BioLiP]