Structure of PDB 4pv1 Chain G

Receptor sequence
>4pv1G (length=37) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
3D structure
PDB4pv1 Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G L5 Q27 L5 Q27
Gene Ontology
Molecular Function
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
GO:0017004 cytochrome complex assembly
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pv1, PDBe:4pv1, PDBj:4pv1
PDBsum4pv1
PubMed25296314
UniProtP83797|PETG_MASLA Cytochrome b6-f complex subunit 5 (Gene Name=petG)

[Back to BioLiP]