Structure of PDB 4lmx Chain G

Receptor sequence
>4lmxG (length=65) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]
AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIKMNAAEA
TSVTKNYNTKLLGAK
3D structure
PDB4lmx Single-residue insertion switches the quaternary structure and exciton states of cryptophyte light-harvesting proteins.
ChainG
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB G K44 M45 A47 K44 M45 A47
BS02 PEB G F14 E16 C20 A22 T25 Q26 K27 A28 G33 C35 F14 E16 C20 A22 T25 Q26 K27 A28 G33 C35
BS03 DBV G N58 K60 L61 A64 K65 N58 K60 L61 A64 K65
BS04 PEB G V13 F14 R17 F34 V13 F14 R17 F34
BS05 PEB G M2 K4 S6 M2 K4 S6
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:4lmx, PDBe:4lmx, PDBj:4lmx
PDBsum4lmx
PubMed24979784
UniProtU5TBJ3|PHEA2_HEMAN Phycoerythrin alpha-2 subunit (Gene Name=HAND1043_LOCUS7931)

[Back to BioLiP]