Structure of PDB 4kud Chain G

Receptor sequence
>4kudG (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQ
NLLPK
3D structure
PDB4kud N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain.
ChainG
Resolution3.203 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G S15 R30 R43 S46 K76 T77 R78 S1 R16 R29 S32 K62 T63 R64 PDBbind-CN: Kd=0.04uM
BS02 dna G S15 R18 R33 Q42 R43 R78 S1 R4 R19 Q28 R29 R64 PDBbind-CN: Kd=0.04uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kud, PDBe:4kud, PDBj:4kud
PDBsum4kud
PubMed23934152
UniProtP04912|H2A2_YEAST Histone H2A.2 (Gene Name=HTA2)

[Back to BioLiP]