Structure of PDB 4jtd Chain G

Receptor sequence
>4jtdG (length=326) Species: 10116 (Rattus norvegicus) [Search protein sequence]
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFD
TAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKH
IIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYW
GTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHK
IGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQ
QAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG
AIQVLPKLSSSIVHEIDSILGNKPYS
3D structure
PDB4jtd Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
ChainG
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP G G55 W57 D85 Y90 K118 S188 R189 Q214 W243 S244 P245 L246 C248 K254 S263 R264 P304 G323 S325 Q329 E332 N333 G20 W22 D50 Y55 K83 S153 R154 Q179 W208 S209 P210 L211 C213 K219 S228 R229 P269 G288 S290 Q294 E297 N298
Gene Ontology
Molecular Function
GO:0004033 aldo-keto reductase (NADPH) activity
GO:0005249 voltage-gated potassium channel activity
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0016491 oxidoreductase activity
GO:0044325 transmembrane transporter binding
GO:0044877 protein-containing complex binding
GO:1990002 methylglyoxal reductase (NADPH) (acetol producing) activity
Biological Process
GO:0002244 hematopoietic progenitor cell differentiation
GO:0006813 potassium ion transport
GO:0045445 myoblast differentiation
GO:0050905 neuromuscular process
GO:0055085 transmembrane transport
GO:0070995 NADPH oxidation
GO:0071805 potassium ion transmembrane transport
GO:0098900 regulation of action potential
GO:1901379 regulation of potassium ion transmembrane transport
GO:2000008 regulation of protein localization to cell surface
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0009898 cytoplasmic side of plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030424 axon
GO:0034705 potassium channel complex
GO:0043005 neuron projection
GO:0043194 axon initial segment
GO:0043679 axon terminus
GO:0044224 juxtaparanode region of axon
GO:0045202 synapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse
GO:1990031 pinceau fiber

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jtd, PDBe:4jtd, PDBj:4jtd
PDBsum4jtd
PubMed23705070
UniProtP62483|KCAB2_RAT Voltage-gated potassium channel subunit beta-2 (Gene Name=Kcnab2)

[Back to BioLiP]