Structure of PDB 4jjn Chain G

Receptor sequence
>4jjnG (length=106) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
LLPKKS
3D structure
PDB4jjn Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
ChainG
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G Q16 R33 R78 Q1 R18 R63
BS02 dna G R30 R43 I44 G45 S46 T77 R78 R15 R28 I29 G30 S31 T62 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jjn, PDBe:4jjn, PDBj:4jjn
PDBsum4jjn
PubMed23650358
UniProtP04912|H2A2_YEAST Histone H2A.2 (Gene Name=HTA2)

[Back to BioLiP]