Structure of PDB 4i4z Chain G

Receptor sequence

>4i4zG (length=275) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa)

MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAR
EDNRIGVVLLTGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLD
LQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVG
SFDGGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRL
EEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMT
EEGSEGKQAFLEKRPPDFSQYPWLP

3D structure

• PDB: 4i4z Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme a synthase from the crotonase fold superfamily
• Chain: G
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G77 R82 Y87 R95 L99 G123 V126 G146 S151 D153 G154 A240 Y248
• Catalytic site (residue number reindexed from 1): G77 R82 Y87 R95 L99 G123 V126 G146 S151 D153 G154 A240 Y248
• Enzyme Commision number: 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2NE	G	H29 K30 R31 A33 S75 G76 G77 D78 Q79 Y87 I121 G123 T145 V149	H29 K30 R31 A33 S75 G76 G77 D78 Q79 Y87 I121 G123 T145 V149
BS02	BCT	G	G122 Q144 G146 W174	G122 Q144 G146 W174

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008935 1,4-dihydroxy-2-naphthoyl-CoA synthase activity
• GO:0016829 lyase activity

Biological Process

• GO:0009234 menaquinone biosynthetic process
• GO:0042372 phylloquinone biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4i4z, PDBe:4i4z, PDBj:4i4z
• PDBsum: 4i4z
• PubMed: 23658663
• UniProt: P73495