Structure of PDB 4cbk Chain G

Receptor sequence

>4cbkG (length=69) Species: 398511 (Alkalihalophilus pseudofirmus OF4)

MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGV
PLAEAVPIIAIVISLLILF

3D structure

• PDB: 4cbk The C-Ring Ion-Binding Site of the ATP Synthase from Bacillus Pseudofirmus of4 is Adapted to Alkaliphilic Lifestyle.
• Chain: G
• Resolution: 2.42 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E54
• Catalytic site (residue number reindexed from 1): E54

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DPV	G	I19 K26	I19 K26

Gene Ontology

Molecular Function

• GO:0008289 lipid binding
• GO:0015078 proton transmembrane transporter activity
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:4cbk, PDBe:4cbk, PDBj:4cbk
• PDBsum: 4cbk
• PubMed: 24707994
• UniProt: P22483|ATPL_ALKPO ATP synthase subunit c (Gene Name=atpE)