Structure of PDB 4bqa Chain G

Receptor sequence
>4bqaG (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD
3D structure
PDB4bqa Structural Insights Into the Autoregulation and Cooperativity of the Human Transcription Factor Ets-2.
ChainG
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G Y414 R419 R422 Y423 Y425 K432 R437 Y438 Y54 R59 R62 Y63 Y65 K72 R77 Y78 PDBbind-CN: Kd=0.3nM
BS02 dna G Q364 W403 K407 M412 Y423 Y424 Q4 W43 K47 M52 Y63 Y64 PDBbind-CN: Kd=0.3nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bqa, PDBe:4bqa, PDBj:4bqa
PDBsum4bqa
PubMed25670864
UniProtP15036|ETS2_HUMAN Protein C-ets-2 (Gene Name=ETS2)

[Back to BioLiP]