Structure of PDB 3vrb Chain G

Receptor sequence
>3vrbG (length=150) Species: 6253 (Ascaris suum) [Search protein sequence]
EKTPIQVWGWDYLMRQRALKRPIAPHLTIYKPQMTWMVSGLHRVTGCAMA
GTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIAFHTL
NGIRFIGFDMAKGTDIPSIYRGAYLVLGLAALISLAVVVYPRWERHKKAT
3D structure
PDB3vrb Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
ChainG
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FTN G W69 S72 R76 W36 S39 R43
BS02 HEM G H75 R76 G79 M82 H131 T132 H42 R43 G46 M49 H98 T99
BS03 EPH G M82 I123 P174 M49 I90 P141
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0045273 respiratory chain complex II (succinate dehydrogenase)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vrb, PDBe:3vrb, PDBj:3vrb
PDBsum3vrb
PubMed22577165
UniProtP92506|DHSC_ASCSU Succinate dehydrogenase [ubiquinone] cytochrome b large subunit, mitochondrial (Gene Name=SDHC)

[Back to BioLiP]