Structure of PDB 3lm1 Chain G

Receptor sequence

>3lm1G (length=133) Species: 3496 (Maclura pomifera)

GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITG
FKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTN
GTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL

3D structure

• PDB: 3lm1 Characterization of the secondary binding sites of Maclura pomifera agglutinin by glycan array and crystallographic analyses.
• Chain: G
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	G	T10 F60 P61 Y64 L112 L133	T10 F60 P61 Y64 L112 L133
BS02	peptide	G	V72 T79 I81 F104 L106 D125 Y126 F127 S128 I129 Y130 L131	V72 T79 I81 F104 L106 D125 Y126 F127 S128 I129 Y130 L131
BS03	peptide	G	P107 E109 N110 L133	P107 E109 N110 L133
BS04	LEC	G	G1 E76 Y78 G121 Y122 W123 D125	G1 E76 Y78 G121 Y122 W123 D125	MOAD: Kd=20uM

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding

External links

• PDB: RCSB:3lm1, PDBe:3lm1, PDBj:3lm1
• PDBsum: 3lm1
• PubMed: 20826825
• UniProt: P18674|LECA_MACPO Agglutinin alpha chain