Structure of PDB 3jam Chain G

Receptor sequence

>3jamG (length=226) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

MKLNISYPINGTQKCIEIDDEHRVRVFYDKRIGQEVDGESVGDEFKGYVF
KIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGA
IVGPDLAVLALIITKKGEQEIEGITNDTVPKRLGPKRANNIRKFFGLTKE
DDVRDYVIRREVTKGDKSYTKAPKIQRLVTPQRLQRKRQQKSLKIKNAQA
QREAAAEYAQLLAKRLSERKAEKAEV

3D structure

PDB

3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

3.46 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K2 N4 S6 Q13 C15 A53 N56 Q59 G60 F61 Q65 G66 V67 L76 S82 C83 Y84 R87 R88 N89 G90 E91 R92 K93 R94 K95 S96 V108 I112 R132 L133 G134 P135 K136 R137 N139 N140 K143 R154 I158 R159 R160 K167 Y169 K171 A172 P173 K174 I175 Q176 R177 R183 L184 Q185 R186 K187 R188 Q190 I195 Q201 R202 L216 K220	K2 N4 S6 Q13 C15 A53 N56 Q59 G60 F61 Q65 G66 V67 L76 S82 C83 Y84 R87 R88 N89 G90 E91 R92 K93 R94 K95 S96 V108 I112 R132 L133 G134 P135 K136 R137 N139 N140 K143 R154 I158 R159 R160 K167 Y169 K171 A172 P173 K174 I175 Q176 R177 R183 L184 Q185 R186 K187 R188 Q190 I195 Q201 R202 L216 K220

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jam, PDBe:3jam, PDBj:3jam
PDBsum	3jam
PubMed	26212456
UniProt	Q6CM04\|RS6_KLULA Small ribosomal subunit protein eS6 (Gene Name=RPS6)

[Back to BioLiP]