Structure of PDB 3hdy Chain G

Receptor sequence

>3hdyG (length=360) Species: 1299 (Deinococcus radiodurans)

GFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVL
IHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDT
VNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRG
YTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQN
MLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLE
FRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPR
AEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVA
QALATFRRLQ

3D structure

• PDB: 3hdy Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: G
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R170 R174 R247 R277 E297 Y342 N344
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDU	G	H109 F176 Y179 T180 W184 R198 Y209 F210 N296 R305 Y335 Y370	H81 F148 Y151 T152 W156 R170 Y181 F182 N268 R277 Y307 Y342	MOAD: Kd=66uM
BS02	FDA	G	V35 G36 A40 D59 R60 R61 G66 N67 P84 H85 I86 D242 Y243 Y334 R364 Y371 N372 M373 V376	V7 G8 A12 D31 R32 R33 G38 N39 P56 H57 I58 D214 Y215 Y306 R336 Y343 N344 M345 V348

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hdy, PDBe:3hdy, PDBj:3hdy
• PDBsum: 3hdy
• PubMed: 19836401
• UniProt: Q9RYF1