Structure of PDB 3f5o Chain G

Receptor sequence
>3f5oG (length=136) Species: 9606 (Homo sapiens) [Search protein sequence]
MTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIG
TLHGGLTATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVIT
AHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLG
3D structure
PDB3f5o The mechanisms of human hotdog-fold thioesterase 2 (hTHEM2) substrate recognition and catalysis illuminated by a structure and function based analysis
ChainG
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.2.-
3.1.2.2: palmitoyl-CoA hydrolase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA G G110 K111 T112 L113 F115 G107 K108 T109 L110 F112
BS02 UOC G G81 V82 K136 G78 V79 K133
BS03 COA G V82 S83 H137 V79 S80 H134
BS04 COA G Y90 M91 S92 P93 Y87 M88 S89 P90
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0047617 fatty acyl-CoA hydrolase activity
Biological Process
GO:0006629 lipid metabolic process
GO:0051289 protein homotetramerization
GO:0120163 negative regulation of cold-induced thermogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3f5o, PDBe:3f5o, PDBj:3f5o
PDBsum3f5o
PubMed19170545
UniProtQ9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 (Gene Name=ACOT13)

[Back to BioLiP]