Structure of PDB 3efx Chain G

Receptor sequence

>3efxG (length=95) Species: 562,243277

APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQV
EVPQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA

3D structure

• PDB: 3efx Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin: 1.9 A crystal structure reveals the details
• Chain: G
• Resolution: 1.94 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FUC	G	Y18 T47 N94	Y18 T47 N87
BS02	FUC	G	N44 A46	N44 A46

Gene Ontology

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3efx, PDBe:3efx, PDBj:3efx
• PDBsum: 3efx
• PubMed: 15341730
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB);
  P0CK94|ELBH_ECOLX Heat-labile enterotoxin B chain (Gene Name=eltB)