Structure of PDB 3azj Chain G

Receptor sequence
>3azjG (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN
3D structure
PDB3azj Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
ChainG
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna G R29 R42 G44 A45 K75 T76 R77 R15 R28 G30 A31 K61 T62 R63
BS02 dna G K15 T16 R17 R20 R29 R32 R42 K1 T2 R3 R6 R15 R18 R28
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3azj, PDBe:3azj, PDBj:3azj
PDBsum3azj
PubMed21812398
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]