Structure of PDB 3apy Chain G

Receptor sequence

>3apyG (length=291) Species: 300852 (Thermus thermophilus HB8)

MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITY
GAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGV
ENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYP
EGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGI
GIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIG
VEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP

3D structure

• PDB: 3apy Properties and Crystal Structure of Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8.
• Chain: G
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S16 E18 D109 F220 H270
• Catalytic site (residue number reindexed from 1): S16 E18 D109 F220 H270
• Enzyme Commision number: 1.5.1.54: methylenetetrahydrofolate reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	G	T49 Y50 H77 L106 R107 G108 D109 Y126 A127 Y149 H153 S156 H165 K169 Q180	T49 Y50 H77 L106 R107 G108 D109 Y126 A127 Y149 H153 S156 H165 K169 Q180

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004489 methylenetetrahydrofolate reductase (NAD(P)H) activity
• GO:0016491 oxidoreductase activity
• GO:0071949 FAD binding
• GO:0106312 methylenetetrahydrofolate reductase (NADH) activity

Biological Process

• GO:0006555 methionine metabolic process
• GO:0009086 methionine biosynthetic process
• GO:0035999 tetrahydrofolate interconversion

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3apy, PDBe:3apy, PDBj:3apy
• PDBsum: 3apy
• PubMed: 21858212
• UniProt: Q5SLG6