Structure of PDB 3ag2 Chain G |
>3ag2G (length=84) Species: 9913 (Bos taurus) [Search protein sequence] |
ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPY HHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
|
PDB | 3ag2 Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate |
Chain | G |
Resolution | 1.802 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DMU |
G |
S61 W62 G63 |
S61 W62 G63 |
|
|
|
|