Structure of PDB 2zjp Chain G

Receptor sequence

>2zjpG (length=142) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

KTYIPKNDEQNWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDF
VVVINAAQVALTGKKLDDKVYTRYTGYQGGLKTETAREALSKHPERVIEH
AVFGMLPKGRQGRAMHTRLKVYAGETHPHSAQKPQVLKTQPL

3D structure

PDB

2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K30 T31 W41 P50 G52 R53 T56 N73 F79 T91 K93 D97 K98 R102 Y103 T104 Q107 G108 L110 R125 E128 A130 G133 M134 R139 Q140 R142 K149 K162	K1 T2 W12 P21 G23 R24 T27 N44 F50 T62 K64 D68 K69 R73 Y74 T75 Q78 G79 L81 R96 E99 A101 G104 M105 R110 Q111 R113 K120 K133

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
PDBsum	2zjp
PubMed	18406324
UniProt	Q9RXY1\|RL13_DEIRA Large ribosomal subunit protein uL13 (Gene Name=rplM)