Structure of PDB 2ykr Chain G

Receptor sequence

>2ykrG (length=151) Species: 668369 (Escherichia coli DH5[alpha])

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A

3D structure

• PDB: 2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
• Chain: G
• Resolution: 9.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	P1 R2 R3 R4 V5 I6 G7 Q8 R9 K10 I11 L12 K24 N27 I28 M30 V31 D32 G33 K34 K35 S36 T37 I41 K75 S76 R77 R78 V79 G80 G81 R91 V93 R94 A97 L98 R101 E105 K109 R110 G111 D112 K113 S114 M115 R118	P1 R2 R3 R4 V5 I6 G7 Q8 R9 K10 I11 L12 K24 N27 I28 M30 V31 D32 G33 K34 K35 S36 T37 I41 K75 S76 R77 R78 V79 G80 G81 R91 V93 R94 A97 L98 R101 E105 K109 R110 G111 D112 K113 S114 M115 R118

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
• PDBsum: 2ykr
• PubMed: 21788480
• UniProt: P02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)