Structure of PDB 2xzw Chain G

Receptor sequence
>2xzwG (length=110) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence]
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTEEYTVEF
LQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTG
EKNADAISAW
3D structure
PDB2xzw Mechanism of 2-Oxoglutarate Signaling by the Synechococcus Elongatus Pii Signal Transduction Protein.
ChainG
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP G G35 F36 G37 R38 Q39 G87 G89 K90 G35 F36 G37 R38 Q39 G82 G84 K85
BS02 ATP G G27 M28 T29 V64 R101 R103 G27 M28 T29 V59 R96 R98
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0042802 identical protein binding
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xzw, PDBe:2xzw, PDBj:2xzw
PDBsum2xzw
PubMed21041661
UniProtP0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)

[Back to BioLiP]