Structure of PDB 2r9r Chain G

Receptor sequence

>2r9rG (length=326) Species: 10116 (Rattus norvegicus) [Search protein sequence]

LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFD
TAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKH
IIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYW
GTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHK
IGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQ
QAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG
AIQVLPKLSSSIVHEIDSILGNKPYS

3D structure

PDB

2r9r Atomic structure of a voltage-dependent K+ channel in a lipid membrane-like environment.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	G	G55 W57 Q63 D85 Y90 K118 S188 R189 Q214 W243 S244 P245 L246 A247 C248 G249 K254 S263 R264 P304 L321 L322 G323 A324 S325 Q329 E332 N333	G20 W22 Q28 D50 Y55 K83 S153 R154 Q179 W208 S209 P210 L211 A212 C213 G214 K219 S228 R229 P269 L286 L287 G288 A289 S290 Q294 E297 N298

Gene Ontology

	Molecular Function
GO:0004033	aldo-keto reductase (NADPH) activity
GO:0005249	voltage-gated potassium channel activity
GO:0005515	protein binding
GO:0015459	potassium channel regulator activity
GO:0016491	oxidoreductase activity
GO:0044325	transmembrane transporter binding
GO:0044877	protein-containing complex binding
GO:1990002	methylglyoxal reductase (NADPH) (acetol producing) activity

	Biological Process
GO:0002244	hematopoietic progenitor cell differentiation
GO:0006813	potassium ion transport
GO:0045445	myoblast differentiation
GO:0050905	neuromuscular process
GO:0055085	transmembrane transport
GO:0070995	NADPH oxidation
GO:0071805	potassium ion transmembrane transport
GO:0098900	regulation of action potential
GO:1901379	regulation of potassium ion transmembrane transport
GO:2000008	regulation of protein localization to cell surface

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005886	plasma membrane
GO:0008076	voltage-gated potassium channel complex
GO:0009898	cytoplasmic side of plasma membrane
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0030424	axon
GO:0034705	potassium channel complex
GO:0043005	neuron projection
GO:0043194	axon initial segment
GO:0043679	axon terminus
GO:0044224	juxtaparanode region of axon
GO:0045202	synapse
GO:0098839	postsynaptic density membrane
GO:0098978	glutamatergic synapse
GO:1990031	pinceau fiber

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2r9r, PDBe:2r9r, PDBj:2r9r
PDBsum	2r9r
PubMed	18004376
UniProt	P62483\|KCAB2_RAT Voltage-gated potassium channel subunit beta-2 (Gene Name=Kcnab2)

[Back to BioLiP]