Structure of PDB 2qrd Chain G

Receptor sequence

>2qrdG (length=325) Species: 4896 (Schizosaccharomyces pombe)

AMDVQETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLL
TLNNIVSAPLWDSEANKFAGLLTMADFVNVIKYYYQSSSFPEAIAEIDKF
RLLGLREVERKIGAIPPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDG
ETGSEMIVSVLTQYRILKFISMNCKETAMLRVPLNQMTIGTWSNLATASM
ETKVYDVIKMLAEKNISAVPIVNSEGTLLNVYESVDVMHLIQDGDYSNLD
LSVGEALLKRPANFDGVHTCRATDRLDGIFDAIKHSRVHRLFVVDENLKL
EGILSLADILNYIIYDKTDNFESAV

3D structure

• PDB: 2qrd Structural Insight into AMPK Regulation: ADP Comes into Play.
• Chain: G
• Resolution: 2.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	G	I35 I55 R142 T162 R165 R287 H289	I35 I55 R142 T162 R165 R287 H289
BS02	ATP	G	R141 T191 L195 A196 I216 S217 R290 I303 S305 A307 D308	R141 T191 L195 A196 I216 S217 R290 I303 S305 A307 D308
BS03	ATP	G	R141 Q163 T191 L195 A196 I216 S217 H289 R290 I303 S305 L306 A307 D308	R141 Q163 T191 L195 A196 I216 S217 H289 R290 I303 S305 L306 A307 D308

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0030295 protein kinase activator activity
• GO:0043531 ADP binding

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0007165 signal transduction
• GO:0010514 induction of conjugation with cellular fusion

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex

External links

• PDB: RCSB:2qrd, PDBe:2qrd, PDBj:2qrd
• PDBsum: 2qrd
• PubMed: 17937917
• UniProt: Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma (Gene Name=cbs2)