Structure of PDB 2qa4 Chain G

Receptor sequence
>2qa4G (length=125) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
RKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGT
AELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELE
ASKTPAPIGAGEVPNDIVIPEGDTG
3D structure
PDB2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G R7 K8 T9 I12 K16 V20 P42 S43 R44 Q47 R50 R60 V61 R63 N64 T65 R69 G87 Q88 R1 K2 T3 I6 K10 V14 P36 S37 R38 Q41 R44 R54 V55 R57 N58 T59 R63 G81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
PDBsum2qa4
PubMed17599351
UniProtP15825|RL10_HALMA Large ribosomal subunit protein uL10 (Gene Name=rpl10)

[Back to BioLiP]