Structure of PDB 2noq Chain G

Receptor sequence

>2noqG (length=213) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSL
KLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKL
SKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRS
TIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGS
LVVKSSMGPAFRL

3D structure

PDB

2noq Structure of the ribosome-bound cricket paralysis virus IRES RNA.

Chain

Resolution

7.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	I117 K118 Q119 V120 P121 R122 L123 L124 G125 P126 S129	I114 K115 Q116 V117 P118 R119 L120 L121 G122 P123 S126
BS02	rna	G	Q35 K98 L99 K101 K102 K105 N108 Q127 K130 K156 Q158 K160 K161 V162 L163 C164 L165 A166	Q32 K95 L96 K98 K99 K102 N105 Q124 K127 K153 Q155 K157 K158 V159 L160 C161 L162 A163

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000055	ribosomal large subunit export from nucleus
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2noq, PDBe:2noq, PDBj:2noq
PDBsum	2noq
PubMed	17115051
UniProt	P0CX43\|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]