Structure of PDB 2j4e Chain G

Receptor sequence
>2j4eG (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]
SMAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEP
DEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEG
LHQLLAGFEDKSAYALCTFALSTPVRLFRGRTSGRIVAPRGCQDFGWDPC
FQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFG
3D structure
PDB2j4e Crystal Structure of Human Inosine Triphosphatase: Substrate Binding and Implication of the Inosine Triphosphatase Deficiency Mutation P32T.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.9: nucleotide diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ITT G T14 N16 K19 K56 T73 I88 F149 W151 D152 K172 H177 R178 T15 N17 K20 K57 T74 I89 F145 W147 D148 K168 H173 R174
BS02 MG G E44 K89 E45 K90
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0016787 hydrolase activity
GO:0035870 dITP diphosphatase activity
GO:0036220 ITP diphosphatase activity
GO:0036222 XTP diphosphatase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0047429 nucleoside triphosphate diphosphatase activity
Biological Process
GO:0006193 ITP catabolic process
GO:0009117 nucleotide metabolic process
GO:0009143 nucleoside triphosphate catabolic process
GO:0009204 deoxyribonucleoside triphosphate catabolic process
GO:0051276 chromosome organization
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2j4e, PDBe:2j4e, PDBj:2j4e
PDBsum2j4e
PubMed17138556
UniProtQ9BY32|ITPA_HUMAN Inosine triphosphate pyrophosphatase (Gene Name=ITPA)

[Back to BioLiP]