Structure of PDB 2gtl Chain G

Receptor sequence
>2gtlG (length=149) Species: 6398 (Lumbricus terrestris) [Search protein sequence]
HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVND
LFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQH
EVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRL
3D structure
PDB2gtl Lumbricus erythrocruorin at 3.5 a resolution: architecture of a megadalton respiratory complex.
ChainG
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM G H97 Q101 H95 Q99
BS02 HEM G L53 F54 R56 V57 I74 H102 R105 H112 F113 F116 I147 L51 F52 R54 V55 I72 H100 R103 H110 F111 F114 I145
BS03 CA G E9 D86 E7 D84
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gtl, PDBe:2gtl, PDBj:2gtl
PDBsum2gtl
PubMed16843898
UniProtP11069|GLB3_LUMTE Extracellular globin-3

[Back to BioLiP]