Structure of PDB 2goy Chain G

Receptor sequence

>2goyG (length=222) Species: 287 (Pseudomonas aeruginosa)

FDLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLN
RNVKVFSLDTGRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKG
LFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQVAVL
EIDGAFSTPEKPLYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIG
CEPCTRPVLPNQHEREGRWWWE

3D structure

• PDB: 2goy Substrate Recognition, Protein Dynamics, and Iron-Sulfur Cluster in Pseudomonas aeruginosa Adenosine 5'-Phosphosulfate Reductase.
• Chain: G
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H219 Y223
• Catalytic site (residue number reindexed from 1): H192 Y196
• Enzyme Commision number: 1.8.4.10: adenylyl-sulfate reductase (thioredoxin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	G	F131 H136 C139 C140 R143 C228 C231	F104 H109 C112 C113 R116 C201 C204

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity
• GO:0016491 oxidoreductase activity
• GO:0043866 adenylyl-sulfate reductase (thioredoxin) activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0000103 sulfate assimilation
• GO:0019344 cysteine biosynthetic process
• GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2goy, PDBe:2goy, PDBj:2goy
• PDBsum: 2goy
• PubMed: 17010373
• UniProt: O05927|CYSH_PSEAE Adenosine 5'-phosphosulfate reductase (Gene Name=cysH)