Structure of PDB 2dym Chain G

Receptor sequence
>2dymG (length=262) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AHMNDIKQLLWNGELNVLVSIDPSFLMKEIAVLRIRVPRETYLVNYMPLI
WNKIKSFLEKYFWFEHNKTPIPWNYPVGVLFDCLATFTTSFENQVKDVLT
FLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMS
LSVNEARKFWGSVITRNFQDFIEISNKISRPRHIPLIIQTSRTSGTFRIS
QPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHMLLYDLYSKLRS
FDGFLYITLVPI
3D structure
PDB2dym Structure of Atg5.Atg16, a complex essential for autophagy
ChainG
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G H0 I4 L7 L8 L13 N14 V15 R36 R38 R41 S104 F105 D111 L113 Q253 I255 E256 H260 M261 K269 H2 I6 L9 L10 L15 N16 V17 R34 R36 R39 S90 F91 D97 L99 Q231 I233 E234 H238 M239 K247
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0016787 hydrolase activity
GO:0019776 Atg8-family ligase activity
GO:0140355 cargo receptor ligand activity
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0016236 macroautophagy
GO:0032258 cytoplasm to vacuole targeting by the Cvt pathway
GO:0034727 piecemeal microautophagy of the nucleus
GO:0044804 nucleophagy
GO:0051365 cellular response to potassium ion starvation
Cellular Component
GO:0000407 phagophore assembly site
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034274 Atg12-Atg5-Atg16 complex
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0061908 phagophore
GO:0120095 vacuole-isolation membrane contact site
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2dym, PDBe:2dym, PDBj:2dym
PDBsum2dym
PubMed17192262
UniProtQ12380|ATG5_YEAST Autophagy protein 5 (Gene Name=ATG5)

[Back to BioLiP]