Structure of PDB 2c5c Chain G |
>2c5cG (length=69) Species: 12371 (Phage h30) [Search protein sequence] |
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV TIKTNACHNGGGFSEVIFR |
|
PDB | 2c5c Extensive Cross-Linking of the Shiga-Like Toxin 1 B Subunit by a Bivalent Ligand |
Chain | G |
Resolution | 2.94 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLA |
G |
N32 W34 N35 |
N32 W34 N35 |
|
|
|
|