Structure of PDB 1yag Chain G |
>1yagG (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] |
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTV QLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQG FESATFLGYFKSGLKYKKGGVASGF |
|
PDB | 1yag The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism |
Chain | G |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
G |
G41 D42 E73 V121 |
G41 D42 E73 V121 |
|
|
|
|