Structure of PDB 1ugy Chain G

Receptor sequence

>1ugyG (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence]

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHVSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

PDB

1ugy Structural Basis of the Carbohydrate Specificities of Jacalin: An X-ray and Modeling Study

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	G	T10 F60 P61 Y64 L112 L133	T10 F60 P61 Y64 L112 L133
BS02	peptide	G	N105 P107 E109 N110 L133	N105 P107 E109 N110 L133
BS03	peptide	G	T72 F104 D125 Y126 F127 S128 M129 Y130 L131	T72 F104 D125 Y126 F127 S128 M129 Y130 L131
BS04	BGC	G	Y78 Y122	Y78 Y122
BS05	GLA	G	G1 Y78 G121 Y122 W123 D125	G1 Y78 G121 Y122 W123 D125

Gene Ontology

	Molecular Function
GO:0019862	IgA binding
GO:0030246	carbohydrate binding

	Biological Process
GO:0008150	biological_process

	Cellular Component
GO:0005575	cellular_component

External links

PDB	RCSB:1ugy, PDBe:1ugy, PDBj:1ugy
PDBsum	1ugy
PubMed	12946359
UniProt	P18670\|LECA_ARTIN Agglutinin alpha chain