Structure of PDB 1tro Chain G

Receptor sequence

>1troG (length=101) Species: 316407 (Escherichia coli str. K-12 substr. W3110)

SPYSAAMAEERHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTR
VRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVL
L

3D structure

• PDB: 1tro Crystal structure of trp repressor/operator complex at atomic resolution.
• Chain: G
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	R54 G76 A77 G78 T81 R84	R50 G72 A73 G74 T77 R80
BS02	dna	G	T44 D46 S67 Q68 R69 I79 S86 K90	T40 D42 S63 Q64 R65 I75 S82 K86
BS03	TRP	G	L41 L43 T44	L37 L39 T40
BS04	TRP	G	R54 R84 G85	R50 R80 G81

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1tro, PDBe:1tro, PDBj:1tro
• PDBsum: 1tro
• PubMed: 3419502
• UniProt: P0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)