Structure of PDB 1tg6 Chain G

Receptor sequence
>1tg6G (length=194) Species: 9606 (Homo sapiens) [Search protein sequence]
PLIPIVVYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPI
HMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPG
MRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQ
SLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLV
3D structure
PDB1tg6 Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
ChainG
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G68 S97 M98 H122 D171
Catalytic site (residue number reindexed from 1) G59 S88 M89 H113 D162
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 FME G G67 G68 V70 S97 M98 H122 P124 G58 G59 V61 S88 M89 H113 P115
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0033619 membrane protein proteolysis
GO:0035694 mitochondrial protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1tg6, PDBe:1tg6, PDBj:1tg6
PDBsum1tg6
PubMed15522782
UniProtQ16740|CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial (Gene Name=CLPP)

[Back to BioLiP]