Structure of PDB 1s5f Chain G

Receptor sequence

>1s5fG (length=102) Species: 666 (Vibrio cholerae)

TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MA

3D structure

• PDB: 1s5f Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
• Chain: G
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	G	E51 Q56 Q61 W88 N90	E51 Q56 Q61 W88 N90

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:1s5f, PDBe:1s5f, PDBj:1s5f
• PDBsum: 1s5f
• PubMed: 15049684
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)