Structure of PDB 1s03 Chain G

Receptor sequence
>1s03G (length=126) Species: 562 (Escherichia coli) [Search protein sequence]
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGD
TKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVV
STSKGVMTDRAARQAGLGGEIICYVA
3D structure
PDB1s03 The structure of a ribosomal protein S8/spc operon mRNA complex.
ChainG
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G P5 S29 K30 R83 Y85 R87 K88 S104 T105 S106 K107 G119 G121 P2 S26 K27 R80 Y82 R84 K85 S101 T102 S103 K104 G116 G118 PDBbind-CN: Kd=0.2uM
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s03, PDBe:1s03, PDBj:1s03
PDBsum1s03
PubMed15146079
UniProtP0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]