Structure of PDB 1p8z Chain G |
>1p8zG (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] |
VVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQ LRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGF ESATFLGYFKSGLKYKKGGVASGFKHVVPNE |
|
PDB | 1p8z From the First to the second domain of gelsolin: A common path on the surface of actin? |
Chain | G |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
G |
G65 D66 E97 V145 |
G40 D41 E72 V120 |
|
|
|
|